.
The Open Protein Structure Annotation Network
PDB Keyword
.

281932

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281932
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18755,TM0051 Molecular Weight 75136.23 Da.
    Residues 669 Isoelectric Point 8.28
    Sequence mpvksltrrseisqkivkvalagcpnvgktslfnaltgtkqyvanwpgvtvekkegvftykgytinlidl pgtyslgyssidekiardyllkgdadlvilvadsvnpeqslyllleilemekkvilamtaideakktgm kidryelqkhlgipvvftssvtgegleelkekiveyaqkntilhrmildygekveseikkvenflrdkk lrinpryfalkylsgdpefysegvklglpelseeerigyrlliakrkreyvenvvkeafadagskslsl seaidhvlthkflsfplffalmylvfkftfdiaqvfsdlldllfsqlgsavvntfgenaftslisdgii ggvgsvlvftpnifamflalgfleesgylpraafvmdrimekfklsgrafmslilgfgcnvpsimatra iddprerlvtilitpfiscsarlpvyllilriffpessaamlfiiyslsilitllssvvinwlfyrgrt splilelpryrmptlknlyiytwnrgkhflkkagtiifvsailiwvlsyfpaagdiensfsamigksle wifkpfgyswkivtslfygavakevvvstmsmlygfeeetflgakealsaemdpvsaiaflifvmayip cfatiatiysetgslkwtlfsigyslsiayvlslivfyvgklvvmli
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0051
    generated 12/2008
    Transmembrane protein

    HMM_TM0051

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch