.
The Open Protein Structure Annotation Network
PDB Keyword
.

281886

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 281886
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18734,TM0005 Molecular Weight 74237.73 Da.
    Residues 650 Isoelectric Point 9.09
    Sequence mtvqqfikklvrlvelernaeinamldemkrlsgeerekkgravlgltgkfigeelgyflvrfgrrkkid teigvgdlvliskgnplksdytgtvvekgerfitvavdrlpswklknvridlfasditfrrqienlmtl ssegkkalefllgkrkpeesfeeeftpfdeglnesqreavslalgssdfflihgpfgtgktrtlveyir qevargkkilvtaesnlavdnlverlwgkvslvrighpsrvsshlkestlahqietsseyekvkkmkee laklikkrdsftkpspqwrrglsdkkileyaeknwsargvskekikemaewiklnsqiqdirdlierke eiiasrivreaqvvlstnssaaleilsgivfdvvvvdeasqatipsilipiskgkkfvlagdhkqlppt ilsedakdlsrtlfeelitrypeksslldtqyrmnellmefpseefydgklkaaekvrnitlfdlgvei pnfgkfwdvvlspknvlvfidtknrsdrferqrkdspsrenpleaqivkevvekllsmgvkedwigiit pyddqvnlirelieakvevhsvdgfqgrekeviiisfvrsnkngeigfledlrrlnvsltrakrkliat gdsstlsvhptyrrfvefvkkkgtyvif
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals
    Modeled
    Model
    generated 12/2008
    Google Scholar output for

    Protein Summary

     

    Ligand Summary

     

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch