.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oet

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site ISPC
    PDB Id 2oet Target Id W00007
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS11916,P00860 Molecular Weight 49546.50 Da.
    Residues 448 Isoelectric Point 4.62
    Sequence mkgfiddanysvglldegtnlgnvidnyvyehtltgknaffvgdlgkivkkhsqwqtvvaqikpfytvk cnstpavleilaalgtgfacssknemalvqelgvspeniiftspckqvsqikyaakvgvnimtcdneie lkkiarnhpnakvllhiatedniggedgnmkfgttlkncrhllecakeldvqiigvkfhvssackeyqv yvhalsdarcvfdmagefgftmnmldigggftgteiqleevnhvisplldiyfpegsgiqiisepgsyy vssaftlavniiakkvvendkfssgvekngsdepafvyymndgvygsfasklsedlntipevhkkyked eplftsslwgpscdeldqivescllpelnvgdwlifdnmgadsfhepsafndfqrpaiyfmmsfsdwye mqdagitsdammknfffapsciqlsqedsfstea
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oet

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch