.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nvb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Thermal stabilization of the protozoan Entamoeba histolytica alcohol dehydrogenase by a single proline substitution. Proteins 72 711-719 2008
    Site ISPC
    PDB Id 2nvb Target Id W00208
    Molecular Characteristics
    Source Archea/bacteria/yeast/amoeba
    Alias Ids TPS11912,P14941 Molecular Weight 37644.93 Da.
    Residues 352 Isoelectric Point 6.38
    Sequence mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilgheavgevvevg sevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvfgeffhvndadmnlahlpk eipleaavmipdmmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgsrpvcvdaa kyygatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpggtianvnyfgegevlpv prlewgcgmahktikgglcpggrlrmerlidlvfykrvdpsklvthvfrgfdniekafmlmkdkpkdli kpvvila
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.278
    Matthews' coefficent 2.76 Rfactor 0.217
    Waters Solvent Content 55.37

    Ligand Information
    Ligands NAP (NADP) x 4
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2nvb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch