The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of NAD(P)H quinone oxidoreductase 1 in complex with its potent inhibitor dicoumarol. Biochemistry 45 6372-6378 2006
    Site ISPC
    PDB Id 2f1o Target Id W00027
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11917,NM_000903 Molecular Weight 30866.04 Da.
    Residues 274 Isoelectric Point 8.91
    Sequence mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdpanfqyp aesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfigefaytyaamydkgpf rskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfqvlepqltysightpadariqileg wkkrleniwdetplyfapsslfdlnfqagflmkkevqdeeknkkfglsvghhlgksiptdnqikark
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.75 Rfree 0.282
    Matthews' coefficent 2.55 Rfactor 0.219
    Waters 122 Solvent Content 51.71

    Ligand Information


    Google Scholar output for 2f1o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch