The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Packing Mediates Enantioselective Ligand Recognition at the Peripheral Site of Acetylcholinesterase. J.Am.Chem.Soc. 127 11029-11036 2005
    Site ISPC
    PDB Id 1zgb Target Id W00568
    Molecular Characteristics
    Source Torpedo californica
    Alias Ids TPS11922,P04058 Molecular Weight 65902.66 Da.
    Residues 586 Isoelectric Point 5.72
    Sequence mnllvtsslgvllhlvvlcqaddhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrp epkkpwsgvwnastypnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiyg ggfysgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdniqf fggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrrravelgrnlncn lnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffptslesmlnsgnfkktqillgvn kdegsffllygapgfskdseskisredfmsgvklsvphandlgldavtlqytdwmddnngiknrdgldd ivgdhnvicplmhfvnkytkfgngtylyffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaee ealsrrimhywatfaktgnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkl lnatacdgelsssgtssskgiifyvlfsilylif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.23
    Matthews' coefficent 4.07 Rfactor 0.188
    Waters 178 Solvent Content 69.70

    Ligand Information
    Ligands NAG (N-ACETYL-D-GLUCOSAMINE) x 2;A1E ((5R)-5-{[10-(1,2,3,4-TETRAHYDROACRIDIN-9-YLAMINO)) x 1


    Google Scholar output for 1zgb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch