.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y7v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of human acid-beta-glucosidase covalently bound to conduritol-B-epoxide. Implications for Gaucher disease. J.Biol.Chem. 280 23815-23819 2005
    Site ISPC
    PDB Id 1y7v Target Id W00572
    Molecular Characteristics
    Source Carrot embrionic cell
    Alias Ids TPS11921,P04062 Molecular Weight 55575.49 Da.
    Residues 497 Isoelectric Point 7.11
    Sequence arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanhtgtgllltl qpeqkfqkvkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyadt pddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgslkgqpgdiyhq twaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqrdfiardlgptlansthhnv rllmlddqrlllphwakvvltdpeaakyvhgiavhwyldflapakatlgethrlfpntmlfaseacvgs kfweqsvrlgswdrgmqyshsiitnllyhvvgwtdwnlalnpeggpnwvrnfvdspiivditkdtfykq pmfyhlghfskfipegsqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltikdpavgfleti spgysihtylwhrq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.28
    Matthews' coefficent 3.07 Rfactor 0.242
    Waters 286 Solvent Content 58.41

    Ligand Information
    Ligands NAG-NAG (N-ACETYL-D-GLUCOSAMINE) x 2;SO4 (SULFATE) x 13;INS (1,2,3,4,5,6-HEXAHYDROXY-CYCLOHEXANE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1y7v

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch