.
The Open Protein Structure Annotation Network
PDB Keyword
.

1v04

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Evolution of the Serum Paraoxonase Family of Detoxifying and Anti-Atherosclerotic Enzymes. Nat.Struct.Mol.Biol. 11 412 2004
    Site ISPC
    PDB Id 1v04 Target Id W00066
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11919,P27169 Molecular Weight 39562.04 Da.
    Residues 355 Isoelectric Point 5.06
    Sequence makltaltllgmglalfdrqkssfqtrfnvhrevtpvelpncnlvkgidngsedleilpnglafissgl kypgimsfdpdksgkillmdlnekepavseleiigntldissfnphgistfidddntvyllvvnhpgss stvevfkfqeeeksllhlktirhkllpsvndivavgpehfyatndhyfidpylkswemhlglawsfvty yspndvrvvaegfdfanginispdgkyvyiaellahkihvyekhanwtltplrvlsfdtlvdnisvdpv tgdlwvgchpngmriffydaenppgsevlriqdilseepkvtvvyaengtvlqgstvaavykgklligt vfhkalycdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.2 Rfree 0.217
    Matthews' coefficent 4.0 Rfactor 0.185
    Waters 115 Solvent Content 64

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 1v04

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch