.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ogs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray Structure of Human Acid-Beta-Glucosidase, the Defective Enzyme in Gaucher Disease. Embo Rep. 4 704 2003
    Site ISPC
    PDB Id 1ogs Target Id W00186
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS11953,P04062 Molecular Weight 55575.49 Da.
    Residues 497 Isoelectric Point 7.11
    Sequence arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanhtgtgllltl qpeqkfqkvkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyadt pddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgslkgqpgdiyhq twaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqrdfiardlgptlansthhnv rllmlddqrlllphwakvvltdpeaakyvhgiavhwyldflapakatlgethrlfpntmlfaseacvgs kfweqsvrlgswdrgmqyshsiitnllyhvvgwtdwnlalnpeggpnwvrnfvdspiivditkdtfykq pmfyhlghfskfipegsqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltikdpavgfleti spgysihtylwhrq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.230
    Matthews' coefficent 2.9 Rfactor 0.195
    Waters 938 Solvent Content 57.5

    Ligand Information
    Ligands SO4 (SULFATE) x 15;NDG (2-(ACETYLAMINO)-2-DEOXY-A-D-GLUCOPYRANOSE) x 1;NAG-NAG (N-ACETYL-D-GLUCOSAMINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ogs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch