The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Rv0301 Rv0300 Toxin Antitoxin Complex from Mycobacterium tuberculosis. to be published
    Site ISFI
    PDB Id 3h87 Target Id ISFI522
    Molecular Characteristics
    Alias Ids TPS28098, Molecular Weight 15745.06 Da.
    Residues 141 Isoelectric Point 5.51
    Sequence mtdqrwlidksalvrltdspdmeiwsnrierglvhitgvtrlevgfsaecgeiarrefrepplsampve yltpriedralevqtlladrghhrgpsipdlliaataelsgltvlhvdkdfdaiaaltgqkterlthrp psa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.49 Rfree 0.174
    Matthews' coefficent 2.77 Rfactor 0.156
    Waters 435 Solvent Content 55.62

    Ligand Information
    Metals MG (MAGNESIUM) x 1


    Google Scholar output for 3h87

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch