The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Thermotoga maritima TM0439: implications for the mechanism of bacterial GntR transcription regulators with Zn2+-binding FCD domains. Acta Crystallogr.,Sect.D 65 356-365 2009
    Site ISFI
    PDB Id 3fms Target Id ISFI332
    Molecular Characteristics
    Alias Ids TPS28092, Molecular Weight 25596.57 Da.
    Residues 225 Isoelectric Point 8.93
    Sequence mdyrqlhrwdlppeeaikvqnelrkkikltpyegepeyvagvdlsfpgkeeglavivvleypsfkilev vsergeitfpyipgllafregplflkaweklrtkpdvvvfdgqglahprklgiashmglfieiptigva ksrlygtfkmpedkrcswsylydgeeiigcvirtkegsapifvspghlmdvesskrlikaftlpgrrip eptrlahiytqrlkkglf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.228
    Matthews' coefficent 2.61 Rfactor 0.157
    Waters 81 Solvent Content 52.91

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals NI (NICKEL) x 1


    Google Scholar output for 3fms

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch