The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of Bacillus subtilis YphP, a prokaryotic disulfide isomerase with a CXC catalytic motif . Biochemistry 48 8664-8671 2009
    Site ISFI
    PDB Id 3fhk Target Id ISFI308
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS28090, Molecular Weight 15874.22 Da.
    Residues 144 Isoelectric Point 4.81
    Sequence msmayeeymrqlvvpmrreltgagfeelttaeevenfmekaegttlvvvnsvcgcaaglarpaatqavl qndktpdntvtvfagqdkeatakmreyftgqepsspsmallkgkevvhfiprheieghdmeeimknlta afdahc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.2464
    Matthews' coefficent 2.73 Rfactor 0.1899
    Waters 249 Solvent Content 54.98

    Ligand Information
    Ligands SO4 (SULFATE) x 12


    Google Scholar output for 3fhk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch