The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative metal-dependent hydrolases APC36150. To be Published
    Site ISFI
    PDB Id 3e4x Target Id ISFI154
    Molecular Characteristics
    Source Bacillus stearothermophilus
    Alias Ids TPS28088, Molecular Weight 17953.61 Da.
    Residues 154 Isoelectric Point 6.79
    Sequence msrakkwvqyflshrhvtmelihkideahydykptptsmtakqlathmlfsfynfantakhgdpslfrq kieepetnlaklaetytektrqliesmsdddfdrtldltaifgtqmstaqflqlamdheihhkgqlfvy vrgmghtdlplfvkrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.51 Rfree 0.259
    Matthews' coefficent 2.02 Rfactor 0.177
    Waters 59 Solvent Content 39.22

    Ligand Information
    Metals NI (NICKEL) x 4


    Google Scholar output for 3e4x

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch