.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dbo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and Proposed Activity of a Member of the VapBC Family of Toxin-Antitoxin Systems: VapBC-5 FROM MYCOBACTERIUM TUBERCULOSIS. J.Biol.Chem. 284 276-283 2009
    Site ISFI
    PDB Id 3dbo Target Id ISFI450
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS28096, Molecular Weight 14407.53 Da.
    Residues 135 Isoelectric Point 4.58
    Sequence msttpaagvldtsvfiatesgrqldealipdrvattvvtlaelrvgvlaaattdiraqrlatlesvadm etlpvdddaarmwarlrihlaesgrrvrindlwiaavaasralpvitqdddfaaldgaasveiirv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.24709
    Matthews' coefficent 1.89 Rfactor 0.21276
    Waters 46 Solvent Content 34.93

    Ligand Information
    Ligands ACT (ACETATE) x 1;BME (BETA-MERCAPTOETHANOL) x 1
    Metals NA (SODIUM) x 4

    Jmol

     
    Google Scholar output for 3dbo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch