The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of RV1404 from Mycobacterium tuberculosis. To be Published
    Site TBSGC
    PDB Id 2nyx Target Id Rv1404
    Molecular Characteristics
    Alias Ids TPS11925,15608542, P71672, 15608542, NP_215920.1 Molecular Weight 17520.08 Da.
    Residues 160 Isoelectric Point 5.75
    Sequence mmpteypataeesvdvitdalltasrllvaisahsiaqvdenitipqfrtlvilsnhgpinlatlatll gvqpsatgrmvdrlvgaelidrlphptsrrellaaltkrgrdvvrqvtehrrteiariveqmapaerhg lvraltafteaggepdaryeie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.273
    Matthews' coefficent 2.13 Rfactor 0.229
    Waters 142 Solvent Content 42.30

    Ligand Information


    Google Scholar output for 2nyx

    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch