.
The Open Protein Structure Annotation Network
PDB Keyword
.

ISFI507

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site David Eisenberg
    Status Purified
    Target Id ISFI507
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32192, TM0905 Molecular Weight 26372.06 Da.
    Residues 229 Isoelectric Point 7.79
    Sequence meyytelvnakdvirpgqnvivevsapedlegqykssvhdvdfekrvltlsmpsfrgrlvplprgtrctv mildssaiyvfrtsvlesgrdedgfpvtkvpfpgrlrkiqrrrfkrikiflegtyrvasrdeppkrfvt rdfsaggmlmvvediltpeqiiyvtldldedlklkdhparvvreagaletgermygveflnvppalerk lvsfvfkkeiemrnkersese
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0905
    generated 12/2008
    Google Scholar output for

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch