.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k19

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of the OmpF porin crystallized in the presence of foscholine-12. Protein Sci. 19 1117-1125 2010
    Site CSMP
    PDB Id 3k19 Target Id 4307C
    Molecular Characteristics
    Source
    Alias Ids TPS31338,C6EI53 Molecular Weight 37082.62 Da.
    Residues 340 Isoelectric Point 4.64
    Sequence aeiynkdgnkvdlygkavglhyfskgngensyggngdmtyarlgfkgetqinsdltgygqweynfqgnn segadaqtgnktrlafaglkyadvgsfdygrnygvvydalgytdmlpefggdtaysddffvgrvggvat yrnsnffglvdglnfavqylgknerdtarrsngdgvggsisyeyegfgivgaygaadrtnlqeaqplgn gkkaeqwatglkydanniylaanygetrnatpitnkftntsgfanktqdvllvaqyqfdfglrpsiayt kskakdvegigdvdlvnyfevgatyyfnknmstyvdyiinqidsdnklgvgsddtvavgivyqf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 3.79 Rfree 0.28794
    Matthews' coefficent 4.35 Rfactor 0.28017
    Waters Solvent Content 71.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k19

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch