The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Function of human Rh based on structure of RhCG at 2.1 A. Proc.Natl.Acad.Sci.USA 107 9638-9643 2010
    Site CSMP
    PDB Id 3hd6 Target Id 1681S
    Molecular Characteristics
    Source Commercial
    Alias Ids TPS31332,Q9UBD6 Molecular Weight 53176.17 Da.
    Residues 479 Isoelectric Point 5.93
    Sequence mawntnlrwrlpltclllqvimvilfgvfvrydfeadahwwserthknlsdmenefyyrypsfqdvhvm vfvgfgflmtflqrygfsavgfnfllaafgiqwallmqgwfhflqdryivvgvenlinadfcvasvcva fgavlgkvspiqllimtffqvtlfavnefillnllkvkdaggsmtihtfgayfgltvtrilyrrnleqs kerqnsvyqsdlfamigtlflwmywpsfnsaisyhgdsqhraaintycslaacvltsvaissalhkkgk ldmvhiqnatlaggvavgtaaemmlmpygaliigfvcgiistlgfvyltpflesrlhiqdtcginnlhg ipgiiggivgavtaasaslevygkeglvhsfdfqgfngdwtartqgkfqiygllvtlamalmggiivgl ilrlpfwgqpsdencfedavywempegnstvyipedptfkpsgpsvpsvpmvsplpmassvplvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.19505
    Matthews' coefficent 2.68 Rfactor 0.16837
    Waters 116 Solvent Content 54.17

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 1


    Google Scholar output for 3hd6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch