.
The Open Protein Structure Annotation Network
PDB Keyword
.

3gd8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance. Proc.Natl.Acad.Sci.USA 106 7437-7442 2009
    Site CSMP
    PDB Id 3gd8 Target Id 1070S
    Molecular Characteristics
    Source Commercial
    Alias Ids TPS31329,P55087 Molecular Weight 34827.82 Da.
    Residues 323 Isoelectric Point 7.59
    Sequence msdrptarrwgkcgplctrenimvafkgvwtqafwkavtaeflamlifvllslgstinwggtekplpvd mvlislcfglsiatmvqcfghisgghinpavtvamvctrkisiaksvfyiaaqclgaiigagilylvtp psvvgglgvtmvhgnltaghgllveliitfqlvftifascdskrtdvtgsialaigfsvaighlfainy tgasmnparsfgpavimgnwenhwiywvgpiigavlagglyeyvfcpdvefkrrfkeafskaaqqtkgs ymevednrsqvetddlilkpgvvhvidvdrgeekkgkdqsgevlssv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.16453
    Matthews' coefficent 2.73 Rfactor 0.15966
    Waters 62 Solvent Content 54.97

    Ligand Information
    Ligands GOL (GLYCEROL) x 5;BOG (B-OCTYLGLUCOSIDE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3gd8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch