.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c02

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the aquaglyceroporin PfAQP from the malarial parasite Plasmodium falciparum. Nat.Struct.Mol.Biol. 15 619-625 2008
    Site CSMP
    PDB Id 3c02 Target Id 4279S
    Molecular Characteristics
    Source Genomic
    Alias Ids TPS31336,Q8II36_PLAF7 Molecular Weight 28295.62 Da.
    Residues 258 Isoelectric Point 6.94
    Sequence mhmlfyksyvrefigeflgtfvlmflgegatanfhttglsgdwyklclgwglavffgilvsaklsgahl nlavsiglssinkfdlkkipvyffaqllgafvgtstvyglyhgfisnskipqfawetsrnpsisltgaf fneliltgilllvilvvvdenicgkfhilklssvvgliilcigitfggntgfalnpsrdlgsrflslia ygkdtftkdnfyfwvplvapcvgsvvfcqfydkvicplvdlannekdgvdl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.19824
    Matthews' coefficent 3.64 Rfactor 0.18088
    Waters 56 Solvent Content 66.23

    Ligand Information
    Ligands GOL (GLYCEROL) x 5;BOG (B-OCTYLGLUCOSIDE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c02

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch