.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bhs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nitrosomonas europaea Rh50 and mechanism of conduction by Rhesus protein family of channels. To be Published
    Site CSMP
    PDB Id 3bhs Target Id 2009
    Molecular Characteristics
    Source Genomic
    Alias Ids TPS31333,Q82X47 Molecular Weight 44615.66 Da.
    Residues 425 Isoelectric Point 6.05
    Sequence mskhlcftafssialfllcfsswasavapaeinearlvaqynysinilamllvgfgflmvfvrrygfsa ttgtylvvatglplyillrangifghaltphsvdaviyaefavatgliamgavlgrlrvfqyallalfi vpvyllnewlvldnasgltegfqdsagsiaihafgayfglgvsialttaaqraqpiesdatsdrfsmlg smvlwlfwpsfataivpfeqmpqtivntllalcgatlatyflsalfhkgkasivdmanaalaggvaigs vcnivgpvgafvigllggaisvvgfvfiqpmleskaktidtcgvhnlhglpgllggfsailivpgiava qltgigitlalaliggviagalikltgttkqayedshefihlagpedehkaerlvleakteiqglknri daavlsakseg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.99 Rfree 0.23666
    Matthews' coefficent 2.91 Rfactor 0.19628
    Waters 154 Solvent Content 57.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bhs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch