The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for conductance by the archaeal aquaporin AqpM at 1.68 A. Proc.Natl.Acad.Sci.Usa 102 18932-18937 2005
    Site CSMP
    PDB Id 2f2b Target Id 4278S
    Molecular Characteristics
    Source Genomic
    Alias Ids TPS31335,Q9C4Z5 Molecular Weight 25346.31 Da.
    Residues 246 Isoelectric Point 5.74
    Sequence mvsltkrciaefigtfilvffgagsaavtlmiasggtspnpfnigigllgglgdwvaiglafgfaiaas iyalgnisgchinpavtiglwsvkkfpgrevvpyiiaqllgaafgsfiflqcagigaatvgglgatapf pgisywqamlaevvgtfllmitimgiavderapkgfagiiigltvagiittlgnisgsslnpartfgpy lndmifagtdlwnyysiyvigpivgavlaaltyqyltse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.68 Rfree 0.193
    Matthews' coefficent 3.09 Rfactor 0.184
    Waters 129 Solvent Content 60.15

    Ligand Information
    Ligands GOL (GLYCEROL) x 1


    Google Scholar output for 2f2b

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch