.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP90764

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP90764
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32994,99287, 16763436 TM0046 Molecular Weight 105666.74 Da.
    Residues 944 Isoelectric Point 5.65
    Sequence msdykstlnlpetgfpmrgdlakrepgmlarwtdddlygiiraakkgkktfilhdgppyangsihighsv nkilkdiivkskglsgfdspyvpgwdchglpielkveqefgkpgekftaaefrakcreyaatqvdgqrk dfirlgvlgdwshpyltmdfkteaniiralgriiknghlhkgakpvhwcvdcrsalaeaeveyydktsp sidvafravdqdavkakfglpgvsgpvslviwtttpwtlpanraislapdfdyalvqidgqavilakdl vesvmqrigaaeytilgtvkgaelellrfthpfmgfdvpailgdhvtldagtgavhtapghgpddyvig qkygletanpvgpdgtylpgtyptldgvnvfkandiviellkekgallhvekmqhsypccwrhktpiif ratpqwfvsmdkeglrqqslkeikgvqwipdwgqariesmvanrpdwcisrqrtwgvpmslfvhketqe llpiertlaameevakrvevdgiqawwdldpkeilgedadqyekvpdtldvwfdsgstsysvvdarpef aghaadmylegsdqhrgwfmsslmisvamkgkapyrqvlthgftvdgqgrkmsksigntvspqdvmnkl gadilrlwvastdytgemavsdeilkraadsyrrirntarfllanlngfnpatdmvkpeemvvldrwav gcaktaqqeilkayeaydfhevvqrlmrfcsvemgsfyldiikdrqytakadsvarrscqtalyhiaea lvrwmapimsftadeiwgylpgerekyvftgewydglfgleeneefndafwddvryikdqvnkelenqk angiksnleakvtlkyaddangtikklkllgeevrfifitsqfviseqaggiddeniqynagnttvqav vtraegdkcprcwhyttdvgkvaehadicgrcvsniagngeqrkfa
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch