.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP02694

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP02694
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32471,99287, 16764676 TM1325 Molecular Weight 10441.94 Da.
    Residues 96 Isoelectric Point 4.35
    Sequence masgditryvitvtfhedslteinelnnhltrsgflltltddegdvhelgtntfgfvsaqsadeikalva glaksaldkdvditvatweawsknaq
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1325
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch