.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01965

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP01965
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32971,99287, 16765127 TM1786 Molecular Weight 40571.13 Da.
    Residues 372 Isoelectric Point 7.88
    Sequence mnneetfyqamrrkgvtrrsflkfcslaatslglgagmtpkiawalenkpripvvwihglectcctesfi rsshplakdvilslisldyddtlmaaagaqaeevfddittryagkyilavegnpplgeqgmfcisggrp fieklkkaaagasaiiawgncaswgcvqaarpnptqatpidkvitdkpivkvpgcppipdvmsaiitym vtfdrlpeldrmgrplmfygqrihdkcyrrahfdagefveswdddaarkgyclykmgckgpttynacss trwndgvsfpiqsghgclgcsengfwdrgsfysrvvdipqmgthstadtvgltalgvvaagvgghavas alnqrkrhkqqlaqaeqqpdnedkqa
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch