.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP01949

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP01949
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32724,99287, 16765163 TM1822 Molecular Weight 12586.65 Da.
    Residues 114 Isoelectric Point 4.81
    Sequence msivridaedrwsdvviynntlwytgvpenldadafeqtantlaqidavlekqgssksrildatiflsdk adfaamnkawdawvvaghapvrctvqaglmnpkykveikivaav
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1822
    generated 12/2008
    Transmembrane protein

    HMM_TM1822

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch