.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00970

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Expressed
    Target Id IDP00970
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32712,99287, 16765025 TM1682 Molecular Weight 18024.52 Da.
    Residues 168 Isoelectric Point 4.93
    Sequence msqtvhfqgnpvtvanvipqagskaqaftlvakdlsdvslsqyagkrkvlnifpsidtgvcaasvrkfnq lateventvvlcvsadlpfaqsrfcgaeglsnvitlstlrnneflknygveivdgplkglaaravivld endnvifsqlvdeithepdydaalnvlka
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1682
    generated 12/2008
    Transmembrane protein

    HMM_TM1682

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch