.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00941

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP00941
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26358,99287, 16764208 TM0846 Molecular Weight 44340.35 Da.
    Residues 413 Isoelectric Point 5.08
    Sequence mfmefsaglmpletaltqmlsritpltavetlplvncfgrilatdivspldvpgfdnsamdgyavrvadl sadkplpvagkafagqpyqgewpagtcirimtgapvpagceavvmqeqteqtddgvrftadvrcgqnir rrgedirqdavvfpagtrlttaelpvlaslgiadaqvvrkvrvalfstgdelqlpgqpleagqiydtnr ltihlmlqqlgcevinlgiipddpgklraafidadsqadvvissggvsvgeadytktileelgeiafwk laikpgkpfafgklsnswfcglpgnpvsaaltfyqlvqpllaklggntasavpprqrvrtasrlkktpg rldfqrgilqrsangelevtttghqgshifssfslgncfivlerergnvepgewvevepfnalfggl
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0846
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch