The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00933
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32195,99287, 16764039 TM0662 Molecular Weight 26604.69 Da.
    Residues 241 Isoelectric Point 7.73
    Sequence mitlknvskwyghfqvltdcstevkkgevvvvcgpsgsgkstliktvnglepvqkgeitvngiivndkkt dlaklrsrvgmvfqhfelfphlsiienltlaqvkvlkrdkaaardkglkllervglsahankfpaqlsg gqqqrvaiaralcmdpiamlfdeptsaldpeminevldvmvelanegmtmmvvthemgfarkvanrvif mdegkivedspkeeffanpssdrakdflakilh
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0662
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch