The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00915
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26386,99287, 16763626 TM0236 Molecular Weight 48401.89 Da.
    Residues 430 Isoelectric Point 8.20
    Sequence mttltlntsllssrrilaafsggldstvllhqlvlwrerhpdvtlraihihhglsphadswvrhcetvce rwqvplvvervtladnglgieaharearyrafaqtllpgevlataqhlddqcetfllalkrgsgpagls amgerspfagtlllrpllretrktleqwavrhglcwiedesnqddaydrnflrlralpllqqrwphfpa avarsatlcaeqerlldellasdltdcitaegtlrlsplmsmsdvrraailrrwlamrnapmpsrdale riwqevalarddaspclrfgdheirryqsqlwwiksvagqhettvawpvwqtplalpaglgtvqlvpgg elrrpreeesvsirfkapgvlhivgrnggrklkkiwqeqgippwrrdttpllfygetliaaagvfvtre gaaedkegvslvwha
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM0236
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch