.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00913

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Work Stopped
    Target Id IDP00913
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32515,99287, 16763609 TM0219 Molecular Weight 20554.39 Da.
    Residues 185 Isoelectric Point 7.76
    Sequence misdirkdaevrmekcveafktqiskvrtgraspslldgivveyygtptplrqlasvtvedsrtlkinvf drsmgpavekaimasdlglnpssagtdirvplpplteerrkdltkivrgeaeqarvavrnvrrdandkv kallkdkaisedddrrsqeevqkmtdaaikkvdaaladkeaelmqf
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0219
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch