.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00903

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Purified
    Target Id IDP00903
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26430,99287, 16763513 TM0123 Molecular Weight 53283.75 Da.
    Residues 495 Isoelectric Point 5.70
    Sequence madrnlrdllapwvaglparelremtldsrvaaagdlfvavvghqadgrryipqaiaqgvaaiiaeakde asdgeiremhgvpvvylsqlnerlsalagrfyhepsenmrlvavtgtngkttttqllaqwsqllgetsa vmgtvgngllgkviptenttgsavdvqhvlaslvaqgatfgamevsshglvqhrvaalkfaasvftnls rdhldyhgdmahyeaakwmlysthhhgqaivnaddevgrrwlaslpdavavsmeghinpnchgrwlkae aveyhdrgatirfasswgegeiesrlmgafnvsnlllalatllalgypltdllktaarlqpvcgrmevf tapgkptvvvdyahtpdalekalqaarlhcagklwcvfgcggdrdkgkrplmgaiaeefadivvvtddn prteepraiindilagmldagqvrvmegraeavtnaimqakdndvvliagkghedyqivgtqrldysdr vtaarllgvia
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0123
    generated 12/2008
    Transmembrane protein

    HMM_TM0123

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch