.
The Open Protein Structure Annotation Network
PDB Keyword
.

IDP00858

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site CSGID
    Status Cloned
    Target Id IDP00858
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS33089,99287, 16764693 TM1342 Molecular Weight 27107.76 Da.
    Residues 249 Isoelectric Point 8.63
    Sequence msqlmqlkdvaestrlgplsgevsageilhlvgpngagkstllarmagltsgegsirfggapleawatat laqhraylaqqqnppfampvwhyltlhqpdktrtgqlnevadmlglgdklgrsvnqlsggewqrvrlaa vvlqihpdanpvgqlllldepmnsldvaqqnaldrvlhhlcqagiaivmsshdlnhtlrhahkawllkr gkliacgrreevltpsylaqayglrfrrldveghpmlisat
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1342

    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch