.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oex

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Type I 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium with close loop conformation. TO BE PUBLISHED
    Site CSGID
    PDB Id 3oex Target Id IDP90922
    Related PDB Ids 3nnt 3l2i 3lb0 3m7w 3o1n 
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS31328,99287, 16764709 Molecular Weight 27323.91 Da.
    Residues 252 Isoelectric Point 5.30
    Sequence mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesvleaagair eiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgddevkatvgyahqhnvav imsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadvltlltatvemqeryadrpiitmsmsk tgvisrlagevfgsaatfgavkkasapgqisvadlrtvltilhqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.20366
    Matthews' coefficent 2.02 Rfactor 0.15180
    Waters 912 Solvent Content 39.17

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3oex

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch