.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mue

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pantoate-beta-Alanine Ligase from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3mue Target Id IDP90797
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS32519,99287, 16763571 Molecular Weight 31856.10 Da.
    Residues 284 Isoelectric Point 5.83
    Sequence mliietlpllrqhirrlrqegkrvalvptmgnlhdghmklvdeakaradvvivsifvnpmqfdrpddlv ryprtlqedceklnkrkvdyvfapaveeiyphglegqtyvdvpglstmlegasrpghfrgvstivsklf nliqpdiacfgekdfqqlalirkmvadmsydieivgvpiirakdglalssrnayltaeqrkiapglynv mnsiaekliagnrelqeiiaiaeqelnekgfraddiqirdadtlleltetskravilaaawlgqarlid nqsvtlaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.229
    Matthews' coefficent 3.89 Rfactor 0.178
    Waters 339 Solvent Content 68.35

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands GOL (GLYCEROL) x 16;EOH (ETHANOL) x 5;SO4 (SULFATE) x 2;ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3mue

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch