The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glutaredoxin 1 from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3lgc Target Id IDP01801
    Related PDB Ids 3msz 
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS31294,177416, 56707666 Molecular Weight 10069.96 Da.
    Residues 86 Isoelectric Point 5.28
    Sequence mkvkiytrngcpycvwakqwfeenniafdetiiddyaqrskfydemnqsgkvifpistvpqifiddehi ggftelkanadkilnkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.77 Rfree 0.223
    Matthews' coefficent 3.85 Rfactor 0.175
    Waters 30 Solvent Content 68.04

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 1


    Google Scholar output for 3lgc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch