.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lay

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Alpha-Helical barrel formed by the decamer of the zinc resistance-associated protein (STM4172) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2. To be Published
    Site CSGID
    PDB Id 3lay Target Id IDP01826
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS31295,99287, 16767426 Molecular Weight 16128.28 Da.
    Residues 151 Isoelectric Point 9.24
    Sequence mkrnnksaialialsllalssgaafaghhwgnndgmwqqggspltteqqataqkiyddyytqtsalrqq liskryeynalltasspdtakinavakemeslgqkldeqrvkrdvamaqagiprgagmgyggcggyggg yhrggghmgmgnw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.70 Rfree 0.26720
    Matthews' coefficent Rfactor 0.22263
    Waters 64 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lay

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch