.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l93

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of phosphopantetheine adenylyltransferase from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3l93 Target Id IDP90549
    Related PDB Ids 3l92 
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS31324,214092, 16120406 Molecular Weight 17649.76 Da.
    Residues 159 Isoelectric Point 9.52
    Sequence mitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakkvtaplknvevlg fselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvflipsekwsfissslvkevarh ggditpflpkpvtkallakla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.16 Rfree 0.210
    Matthews' coefficent 4.19 Rfactor 0.175
    Waters 79 Solvent Content 70.63

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3l93

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch