The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A Crystal Structure of a Putative Peptidase E Protein from Listeria monocytogenes EGD-e. To be Published
    Site CSGID
    PDB Id 3l4e Target Id IDP02527
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS31312,169963, 16802408 Molecular Weight 22774.87 Da.
    Residues 205 Isoelectric Point 5.34
    Sequence mknlfltssfkdvvplftefesnlqgktvtfiptastveevtfyveagkkaleslgllveeldiatesl geittklrkndfiyvtggntffllqelkrtgadklileeiaagklyigesagavitspniayiqtmdst kkavnltnydalnlvdfstlphynntpfkeitqkivteyagksqiypisnheaifirgkevitkrls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.2222
    Matthews' coefficent 2.24 Rfactor 0.1692
    Waters 188 Solvent Content 45.16

    Ligand Information
    Ligands SO4 (SULFATE) x 2


    Google Scholar output for 3l4e

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch