The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bacillus anthracis HemL-1, glutamate semialdehyde aminotransferase. TO BE PUBLISHED
    Site CSGID
    PDB Id 3l44 Target Id IDP02280
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS31303,261594, 47525801 Molecular Weight 46429.76 Da.
    Residues 434 Isoelectric Point 5.32
    Sequence mvvkftksealhkealehivggvnspsrsfkavgggapiamergkgayfwdvdgnkyidylaaygpiit ghahphitkaittaaengvlygtptalevkfakmlkeampaldkvrfvnsgteavmttirvaraytgrt kimkfagcyhghsdlvlvaagsgpstlgtpdsagvpqsiaqevitvpfnnvetlkealdkwghevaail vepivgnfgivepkpgflekvnelvheagalviydevitafrfmyggaqdllgvtpdltalgkvigggl pigayggkkeimeqvaplgpayqagtmagnpasmasgiaclevlqqeglyekldelgamlekgileqaa khniditlnrlkgaltvyfttntiedydaaqdtdgemfgkffklmlqegvnlapskyeawflttehtke dieytieavgrafaaladnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.192
    Matthews' coefficent 1.99 Rfactor 0.157
    Waters 643 Solvent Content 38.22

    Ligand Information


    Google Scholar output for 3l44

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch