.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kux

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the YPO2259 putative oxidoreductase from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3kux Target Id IDP02458
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS31308,214092, 16122483 Molecular Weight 38123.35 Da.
    Residues 349 Isoelectric Point 5.60
    Sequence madkikvgllgygyasktfhaplimgtpglelagvsssdaskvhadwpaipvvsdpqmlfndpsidliv iptpndthfplaqsalaagkhvvvdkpftvtlsqanalkehaddaglllsvfhnrrwdsdfltlktlla egslgnvvyfeshfdryrpeirqrwreqagagggiwydlgphlldqalqlfglpetlnvdlgmlrpgsq svdyfhavlsypgqrvvlhstvlaaaetaryivhgtqgsyikfgvdpqedrlkagerlpqadwgydmrd givtlshdnvltekplltlpgnypayyagirdaiwgtapnpvpateaikvmelielgiasdqqkkalpiiakn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.75 Rfree 0.245
    Matthews' coefficent 3.06 Rfactor 0.199
    Waters 44 Solvent Content 59.80

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3kux

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch