.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kqf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 Angstrom Resolution Crystal Structure of Enoyl-CoA Hydratase from Bacillus anthracis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3kqf Target Id IDP02329
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS31306,261594, 47527840 Molecular Weight 28461.26 Da.
    Residues 262 Isoelectric Point 5.69
    Sequence mlqlqnisvdyatphvvkislnrerqanslslalleelqniltqineeantrvviltgagekafcagad lkeragmneeqvrhavsmirttmemveqlpqpviaaingialgggtelslacdfriaaesaslgltett laiipgaggtqrlprligvgrakeliytgrrisaqeakeyglvefvvpvhlleekaieiaekiasngpi avrlakeaisngiqvdlhtglqmekqayegvihtkdrleglqafkekrtpmykge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.80 Rfree 0.19325
    Matthews' coefficent 1.85 Rfactor 0.15550
    Waters 868 Solvent Content 33.68

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 5;CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3kqf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch