.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kbo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.14 Angstrom Crystal Structure of Putative Oxidoreductase (ycdW) from Salmonella typhimurium in Complex with NADP. To be Published
    Site CSGID
    PDB Id 3kbo Target Id IDP00951
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26330,99287, 16764491 Molecular Weight 35032.42 Da.
    Residues 312 Isoelectric Point 6.19
    Sequence meiifyhptfnaawwvnalekalpharvrewkvgdnnpadyalvwqppvemlagrrlkavfvlgagvda ilsklnahpemldasiplfrledtgmglqmqeyavsqvlhwfrrfddyqalknqalwkplpeytreefs vgimgagvlgakvaeslqawgfplrcwsrsrkswpgvesyvgreelraflnqtrvlinllpntaqtvgi inselldqlpdgayvlnlargvhvqeadllaaldsgklkgamldvfsqeplpqesplwrhprvamtphi aavtrpaeaidyisrtitqlekgepvtgqvdrargy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.14 Rfree 0.26879
    Matthews' coefficent 2.45 Rfactor 0.21092
    Waters 568 Solvent Content 49.88

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands NDP (NADPH) x 4;NDB (N-(2-HYDROXYETHYL)-N,N-DIMETHYL-3-SULFOPROPAN-1-AMINIUM) x 1;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2
    Metals CL (CHLORIDE) x 8

    Jmol

     
    Google Scholar output for 3kbo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch