.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k29

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and protein-protein interaction studies on Chlamydia trachomatis protein CT670 (YscO Homolog). J.Bacteriol. 192 2746-2756 2010
    Site CSGID
    PDB Id 3k29 Target Id IDP90225
    Molecular Characteristics
    Source Chlamydia trachomatis d/uw-3/cx
    Alias Ids TPS31321,272561, 3329121 Molecular Weight 20286.23 Da.
    Residues 168 Isoelectric Point 7.84
    Sequence mvryplepvlsikkdrvdraekvvkekrrlleleqeklrereserdkvknhymqkirqlreqlddgtts dailkmkayikvvaiqlseeeekvnkqkenvlaaskeleraeveltkrrkeeektrlhkeewmkealke earqeekeqdemgqllhqlhkqkqresgen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.285
    Matthews' coefficent 2.35 Rfactor 0.240
    Waters 51 Solvent Content 47.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k29

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch