.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k28

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a glutamate-1-semialdehyde aminotransferase from Bacillus anthracis with bound Pyridoxal 5'Phosphate. To be Published
    Site CSGID
    PDB Id 3k28 Target Id IDP02781
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS31319,261594, 47529992 Molecular Weight 46057.19 Da.
    Residues 429 Isoelectric Point 5.27
    Sequence mrkfdksiaafeeaqdlmpggvnspvrafksvgmnplfmergkgskvydidgneyidyvlswgplihgh andrvvealkavaergtsfgapteienklaklviervpsieivrmvnsgteatmsalrlargytgrnki lkfigcyhghgdsllikagsgvatlglpdspgvpegvakntitvayndlesvkyafeqfgddiacvive pvagnmgvvppqpgfleglrevteqngallifdevmtgfrvayncgqgyygvtpdltclgkviggglpv gayggkaeimrqvapsgpiyqagtlsgnplamaagyetlvqltpesyveferkaemleaglrkaaekhg iphhinragsmigifftdepvinydaakssnlqffaayyremveqgvflppsqfeglflstvhsdadie atiaaaeiamsklka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.1854
    Matthews' coefficent 2.28 Rfactor 0.1473
    Waters 1513 Solvent Content 45.97

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 4
    Metals CL (CHLORIDE) x 4;CA (CALCIUM) x 10

    Jmol

     
    Google Scholar output for 3k28

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch