.
The Open Protein Structure Annotation Network
PDB Keyword
.

3js3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Type I 3-Dehydroquinate Dehydratase (aroD) from Clostridium difficile with Covalent Reaction Intermediate. TO BE PUBLISHED
    Site CSGID
    PDB Id 3js3 Target Id IDP90163
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS30436,272563, 172044608 Molecular Weight 28874.24 Da.
    Residues 255 Isoelectric Point 6.17
    Sequence mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenikevkevlyel rsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfmgdevidevvnfahkkevk viisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnekdvlvlleatnemfkiyadrpiitmsms gmgvisrlcgeifgsaltfgaaksvsapgqisfkelnsvlnllhksin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.24147
    Matthews' coefficent 2.41 Rfactor 0.18889
    Waters 322 Solvent Content 49.05

    Ligand Information
    Ligands DHS (3-AMINO-4,5-DIHYDROXY-CYCLOHEX-1-ENECARBOXYLATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3js3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch