The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Mg-bound 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961. To be Published
    Site CSGID
    PDB Id 3jr2 Target Id IDP01486
    Related PDB Ids 3ieb 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS30398,243277, 15601010 Molecular Weight 23201.20 Da.
    Residues 215 Isoelectric Point 4.87
    Sequence mtkpmiqialdqtnltdavavasnvasyvdvievgtilafaegmkavstlrhnhpnhilvcdmkttdgg ailsrmafeagadwitvsaaahiatiaackkvadelngeiqieiygnwtmqdakawvdlgitqaiyhrs rdaelagigwttddldkmrqlsalgielsitggivpediylfegiktktfiagralagaegqqtaaalr eqidrfwp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.20233
    Matthews' coefficent 2.60 Rfactor 0.16318
    Waters 766 Solvent Content 52.60

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 5;GOL (GLYCEROL) x 5;SO4 (SULFATE) x 8
    Metals MG (MAGNESIUM) x 7


    Google Scholar output for 3jr2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch