.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of N-acetylglucosamine-6-phosphate deacetylase from Vibrio cholerae complexed with fructose 6-phosphate. To be Published
    Site CSGID
    PDB Id 3iv8 Target Id IDP01334
    Related PDB Ids 3egj 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24739,243277, 15641009 Molecular Weight 40953.66 Da.
    Residues 378 Isoelectric Point 5.33
    Sequence myaltnckiytgndvlvkhaviingdkieavcpieslpsemnvvdlnganlspgfidlqlngcggvmfn deitaetidtmhkanlksgctsflptlitssdenmrqaiaaareyqakypnqslglhlegpylnvmkkg ihsvdfirpsddtmidticansdviakvtlapennkpehieklvkagivvsightnatysearksfesg itfathlfnamtpmvgrepgvvgaiydtpevyagiiadgfhvdyaniriahkikgeklvlvtdatapag aemdyfifvgkkvyyrdgkcvdengtlggsaltmieavqntvehvgialdealrmatlypakaigvdek lgrikkgmianltvfdrdfnvkatvvngqyeqn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.53 Rfree 0.253
    Matthews' coefficent 2.42 Rfactor 0.183
    Waters 332 Solvent Content 49.22

    Ligand Information
    Ligands F6P (FRUCTOSE-6-PHOSPHATE) x 1;SO4 (SULFATE) x 3
    Metals NI (NICKEL) x 4

    Jmol

     
    Google Scholar output for 3iv8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch