.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ist

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamate racemase from Listeria monocytogenes in complex with succinic acid. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ist Target Id IDP00347
    Related PDB Ids 3hfr 3isv 
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS28045,169963, 16803277 Molecular Weight 29158.18 Da.
    Residues 266 Isoelectric Point 5.80
    Sequence mkqaigfidsgvggltvvrevlkqlpheqvyylgdtarcpygprdkeevakftwemtnflvdrgikmlv iacntataaalydirekldipvigviqpgsraalkatrnnkigvlgtlgtvesmayptalkglnrrvev dslacpkfvsvvesgeyksaiakkvvaesllplkstkidtvilgcthypllkpiienfmgdgvavinsg eetasevsalldyhnlldatdeeiehrffttgstqifkdiakdwlnmpdmtvehiklgk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.21145
    Matthews' coefficent 2.39 Rfactor 0.17110
    Waters 483 Solvent Content 48.64

    Ligand Information
    Ligands SIN (SUCCINIC) x 2
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3ist

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch