The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.2 Angstrom Crystal Structure of the Glutaredoxin 2 (grxB) from Salmonella typhimurium in complex with Glutathione. TO BE PUBLISHED
    Site CSGID
    PDB Id 3ir4 Target Id IDP00895
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS26232,99287, 16764521 Molecular Weight 24462.01 Da.
    Residues 215 Isoelectric Point 7.77
    Sequence mklyiydhcpfcvkarmifglknipvelnvlqnddeatptrmigqkmvpilqkddsrylpesmdivhyv dnldgkplltgkrnpaieewlrkvngyvnqlllprfaksafdefstpaarqyfirkkeassgsfdnhla hsaglikkigddlrlldklivqpnavngelseddihlfpllrnltlvagihwptkvadyrdnmakqtqi nllssmai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.14426
    Matthews' coefficent 2.12 Rfactor 0.11671
    Waters 564 Solvent Content 42.05

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands GTT (GLUTATHIONE) x 1;SO4 (SULFATE) x 3
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 3ir4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch